PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030553.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 595aa    MW: 66806 Da    PI: 6.128
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030553.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34357e-133394092350
                  XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkekv 99 
                   l++rmwkd ++lkr+ke++k   ++++ a++++k +++++qarrkkm+raQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++raWWkekv
  CCG030553.1  39 ALERRMWKDHVKLKRIKEKQKL--AAQQ-AAEKQKPKQTTDQARRKKMARAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIRAWWKEKV 133
                  589***********99999885..3455.599****************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.----- CS
         EIN3 100 efdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykk 197
                  +fd+ngpaai+ky+a++l+ ++++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww +lgls  q+ ppykk
  CCG030553.1 134 KFDKNGPAAIAKYEAECLAIGEAENS--RNGNSQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWVKLGLSLGQS-PPYKK 228
                  *********************99988..7899999********************************************************9.9**** PP

                  GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.........XXXXXXXXXXXXXXXXXXXXX CS
         EIN3 198 phdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.........slrkqspkvtlsceqkedveg 286
                  phdlkk+wkv+vLtavikhm p+i++ir+++rqsk+lqdkm+akes+++l vl++ee+++++ s ++            r +++k  +s+++++dv+g
  CCG030553.1 229 PHDLKKMWKVGVLTAVIKHMTPDIAKIRRHVRQSKCLQDKMTAKESAIWLGVLSREESLIQQPSIDNGtsgvtespqGGRGRKKKPAISSDSDYDVDG 326
                  *****************************************************************944446776665555699999***********8 PP

                  XXXXX.XXXXXXXXXX...................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXX CS
         EIN3 287 kkeskikhvqavktta...................gfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsis 350
                   ++   + ++++++++                   + ++ +kr+++++ ++k s  +  ++    ++ g e+ ++++d n+++
  CCG030553.1 327 VDDGVGSVSSKDNRRNqpmdvellssrnditipvqDKELGEKRRRRKRPREKSSHADQQSQPPVDECLGVEQTNTLPDINHTD 409
                  877777888888888899************88888666666666555555555555555677777777778888888877765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.3E-12639285No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-70160292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.11E-62166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MGELEEIGAD ICSDIEVDDI RCGNIAEKDV SDEEIEAEAL ERRMWKDHVK LKRIKEKQKL  60
AAQQAAEKQK PKQTTDQARR KKMARAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
ASDNIRAWWK EKVKFDKNGP AAIAKYEAEC LAIGEAENSR NGNSQSVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWVKLGLSL GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMTP DIAKIRRHVR QSKCLQDKMT AKESAIWLGV LSREESLIQQ PSIDNGTSGV  300
TESPQGGRGR KKKPAISSDS DYDVDGVDDG VGSVSSKDNR RNQPMDVELL SSRNDITIPV  360
QDKELGEKRR RRKRPREKSS HADQQSQPPV DECLGVEQTN TLPDINHTDL QPVEYQMHNT  420
HHENFTSSAL MPMEKGLVGE SSPPQSEFNS YAGVPSTNVN STEKIFVDRG AAIYPLGQNS  480
ELHHETTYSN IYNPSHDYGT NHDGKHSQMA MNMRPEDDRF LKPALHGNGN DLTRGEPHHL  540
AKDTLPTEQD TAVDRHFEFD LPDFAINSPF LEMSSFSLDN LFVDPEDDLI QCFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A8e-771652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366374EKRRRRKRP
2367372KRRRRK
3367373KRRRRKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142770.0AC214277.1 Populus trichocarpa clone ACSB1145-L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025257.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_011025258.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLU5GND40.0U5GND4_POPTR; Uncharacterized protein
STRINGPOPTR_0003s22090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-177ETHYLENE-INSENSITIVE3-like 3